Protein Info for HER17_RS14390 in Pectobacterium carotovorum WPP14

Annotation: 5-deoxy-glucuronate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04962: KduI
  • amino acids 5 to 264 (260 residues), 373.4 bits, E=3e-116
• TIGR04378: 5-deoxy-glucuronate isomerase
  • amino acids 18 to 264 (247 residues), 327.9 bits, E=2.1e-102

Best Hits

Swiss-Prot: 56% identical to IOLB_GEOKA: 5-deoxy-glucuronate isomerase (iolB) from Geobacillus kaustophilus (strain HTA426)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 97% identity to eca:ECA1465)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

• myo-inositol degradation I (6/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (6/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Protein Sequence (278 amino acids)

>HER17_RS14390 5-deoxy-glucuronate isomerase (Pectobacterium carotovorum WPP14)
MSRLLSRHRVPDEHGRTQHITPETAGWRYVGFEVYQLAPEQVLSLPASDNERCLVLVSGK
ATVVTPSERFEQIGDRMSPFERRKPYAVYVTTGETITVTAHTALELAVCAAPGFGTHPTR
LIAPQDIDAEQRGVGNNQRYVHNILPEDKAADSLLVVEVYTDEGCTSSYPSHKHDVDNPP
QETYLEETYYHRLNPEQGFCLQRVYTDDRLLDECMAVYDRDVVQVPRGYHPVATIAGYDS
YYLNVMAGPTRQWRFTWEADHQWINSPEYAENHRQGKV