Protein Info for HER17_RS14220 in Pectobacterium carotovorum WPP14

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 48 to 72 (25 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 192 to 216 (25 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 317 to 344 (28 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details PF00375: SDF" amino acids 6 to 405 (400 residues), 377.5 bits, see alignment E=3.9e-117

Best Hits

Swiss-Prot: 38% identical to GLTP_BACSU: Proton/glutamate-aspartate symporter (gltP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 96% identity to pwa:Pecwa_1780)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (435 amino acids)

>HER17_RS14220 dicarboxylate/amino acid:cation symporter (Pectobacterium carotovorum WPP14)
MQRQKLLVQIVLAIVLGILIGWACHQYLDGSRAKEVASYFNMVTDIFLRLIKMIIAPLVF
ATLVSGLASMGGNSSAVGRIGMKAMIWFVSASFISLLIGMVFANLFQPGAGMNLEIPVQH
VATGLNTDSFTLKSFISHIFPKSIVEAMANNEILQILVFSLFFGSALAYVKGHNKHATTI
ISMIEELTKVMFRVTDYVMALAPIAVFAAIASAITTQGLGLLYDFGKLIGEFYLGLAVLW
GVLFLVGYLFLGKGIVRLAKLIREPTMLAFATASSESAYPKTMEALTKFGVPKKVTSFVL
PLGYSFNLDGSMMYQSFAILFIAQAYNIDLSVTEQILILLTLMITSKGMAGVARASIVVV
AATLPMFSLPEAGILLIIGIDQFLDMGRTATNVIGNSISTAVVASLEKDVHDDDEEEAAD
EVVAYKEPQQATQNS