Protein Info for HER17_RS14110 in Pectobacterium carotovorum WPP14

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 67 to 89 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 252 (173 residues), 75.9 bits, see alignment E=1.8e-25

Best Hits

Swiss-Prot: 31% identical to SSUC_BACSU: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Bacillus subtilis (strain 168)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 96% identity to pwa:Pecwa_1800)

Predicted SEED Role

"FIG00905417: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>HER17_RS14110 ABC transporter permease (Pectobacterium carotovorum WPP14)
MKRTSYVLLSITSVAAVLVLWQWAGAQQWVDPLLLPPLSDIILTAGELAQDGYRQVSLWE
HIAVSVARALSAFSVAIILGVPLGLLMGLSPPIAAVFNPFVQFLRPLPKIALIPLAVVWL
GIGEASKFFLIFIATFLSVVVGACAAVERVERSRIRVAQTLGASRRQIFFHVVLPDTLPE
LFTTVRLAIGIGWTSLIAAEMVAATSGIGWMVMNASAYLRTDIVMLGILLLGGIGYALDL
LLVGAQRVFVPWAGKSS