Protein Info for HER17_RS14085 in Pectobacterium carotovorum WPP14

Annotation: TolC family outer membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 31 to 448 (418 residues), 388.5 bits, see alignment E=2e-120 PF02321: OEP" amino acids 36 to 223 (188 residues), 96.1 bits, see alignment E=1.2e-31 amino acids 249 to 434 (186 residues), 99.2 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 50% identical to APRF_PSEAE: Alkaline protease secretion protein AprF (aprF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K12538, outer membrane protein HasF (inferred from 97% identity to pct:PC1_1407)

Predicted SEED Role

"ABC exporter for hemopore HasA, outer membrane component HasF" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>HER17_RS14085 TolC family outer membrane protein (Pectobacterium carotovorum WPP14)
MLRFSSVYRAAIRSSYAIPLFLTLIYSAPSQALGLMEAWQQALTHDPAFQAAVHARNADS
EEKNIGRAGLLPKVTYDYSQSRNDSTVTAGGQQSERDYTSRASSFSLQQPLIDYAAWSRY
QQGEASAVLADEQLRDASQQLLVRLFQAYTNVLFSREQIALVQAQQRAYREQYQLNQRLF
QQGEGTRTDMLETEARVNLTEAQLIEAQDNLDISLRELETLLGMPVGVDQLAALTPRFTP
QALQPAGYQHWQSLALRHNAQLLALNQSLAVAKYGIERNRAGHLPQVTLVASTRNTQSDT
ENSYNQKYDTRSIGIRVSVPIFAGGGVSAATRQAQERYQQTAREKDEQTATIQTELRRQF
NLVTSSQAKIRAYELTEKSALALVTATQKSVQGGERVNLDVLNAEQQLYGARRDLTEARY
TWLTAWLQLRYYAGTLDEQTLRQLATYFVHL