Protein Info for HER17_RS13990 in Pectobacterium carotovorum WPP14

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 144 to 168 (25 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 364 (347 residues), 118.4 bits, see alignment E=3.6e-38 PF12832: MFS_1_like" amino acids 27 to 173 (147 residues), 28.6 bits, see alignment E=7.9e-11

Best Hits

KEGG orthology group: None (inferred from 98% identity to pwa:Pecwa_1826)

Predicted SEED Role

"Transporter, MFS superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>HER17_RS13990 MFS transporter (Pectobacterium carotovorum WPP14)
MSDLTANRVPRPYPPLLLGSQLVFNIGFYAVVPFLAIFLRDDMLLSGWAIGLVIGLRTFS
QQGMFLVGGALADRFGARVIILCGCVVRISGYLLLALGDSLWPIILGACLTGVGGALFSP
AIEALMAQAGTQSEKEGKRSRSEWFALFAICGELGAVLGPLLGSVLAGYGFQRVALAGAG
VFVIALIVLFFSLPPTQRNQNELQIAPWWETFRQRRFVAFIIAYSAYLFSYNQLYLALPV
ELHRSGSSEKDLGPLFVLASLLVIGLQLPLARFARRVGAARMLPLGFALLAASFFSVALF
ASSTPPDGWQRLLPAISLITLLTLGQMLIVPVGMDLIPRFANNKNLGAHYGALASMGGIA
VLVGNFILGSQLDRALTPSPQAAIPWVLLAAVPLCSSLAMMVICRPFKSASTVNE