Protein Info for HER17_RS13935 in Pectobacterium carotovorum WPP14

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 39 to 58 (20 residues), see Phobius details amino acids 71 to 92 (22 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 134 to 155 (22 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 252 to 275 (24 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 311 to 334 (24 residues), see Phobius details amino acids 346 to 367 (22 residues), see Phobius details amino acids 373 to 391 (19 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 236 (220 residues), 35.1 bits, see alignment E=3.7e-13

Best Hits

KEGG orthology group: K05373, MFS transporter, putative signal transducer (inferred from 88% identity to pct:PC1_1437)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>HER17_RS13935 MFS transporter (Pectobacterium carotovorum WPP14)
MTRYLPYWCFYLHQGMITALIMQGVAGYFRHAGLDLAQLSWLSLTFLPWIAKCLWAPWGE
RHALPLRGNPYLGSLVLLQIAMAATLVVIGVISPEQSVLTIVIALMLLALLSASHDIYAD
GITICTTNASSRALANTAQVGGSYLGILFGSYAFLSIAEQAGWRGGFFALAGLSLLMLIL
PLRYLQQSPIQHSQTQATYHQTRQAARPTLNRLTFKALWPVLAFTAIFYLAMRGMMALQT
VMLIDRQLSLSQLGIVMTVYSTAVSGVGIVLANVLIRRMGALRCLLPVMVVHALLAIVLA
VGYPLYSLNAWIALFGVVNLAAAVGFVTLYNVLMGLVRPHQPASDYALFQSTDAAVAMIV
SIAALQLAHHTNYQTTLGVLACFAVASLWPAKRLSVRLSHAFSEGTSPVVTNQQGQDS