Protein Info for HER17_RS13450 in Pectobacterium carotovorum WPP14

Annotation: malonyl-ACP O-methyltransferase BioC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR02072: malonyl-acyl carrier protein O-methyltransferase BioC" amino acids 14 to 252 (239 residues), 213.9 bits, see alignment E=1.6e-67 PF13489: Methyltransf_23" amino acids 32 to 178 (147 residues), 46.6 bits, see alignment E=9.7e-16 PF01209: Ubie_methyltran" amino acids 38 to 156 (119 residues), 34 bits, see alignment E=6.3e-12 PF13847: Methyltransf_31" amino acids 43 to 152 (110 residues), 54.3 bits, see alignment E=4.2e-18 PF13649: Methyltransf_25" amino acids 48 to 136 (89 residues), 72.3 bits, see alignment E=1.3e-23 PF08241: Methyltransf_11" amino acids 49 to 140 (92 residues), 87.3 bits, see alignment E=2.7e-28 PF08242: Methyltransf_12" amino acids 49 to 138 (90 residues), 46.2 bits, see alignment E=1.9e-15

Best Hits

Swiss-Prot: 92% identical to BIOC_PECAS: Malonyl-[acyl-carrier protein] O-methyltransferase (bioC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02169, biotin synthesis protein BioC (inferred from 92% identity to eca:ECA2823)

Predicted SEED Role

"Biotin synthesis protein BioC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (253 amino acids)

>HER17_RS13450 malonyl-ACP O-methyltransferase BioC (Pectobacterium carotovorum WPP14)
MLTENYNKQAIAQAFGRAAGCYDRFAELQRTSGERLLALMPSHSGLQVLDAGCGTGHFSR
HWRQAGKNVTALDLSVDMLAHAREQHVADRYLEGDIENLPLADCCVDISYSNLAVQWCDS
LPRALAELYRVTRPGGVIAFATLADGSLSELSQAWQRLDGTQRTNRFLSLSAIEAACQPY
RHHVVQEREVCFFPDVLALMKSLKGIGATWLHDGRAPGLLSRARLAALSAHYPQEQGGYP
LSYQLVYGVIYRD