Protein Info for HER17_RS13345 in Pectobacterium carotovorum WPP14

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 56 to 76 (21 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 230 to 260 (31 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details PF01032: FecCD" amino acids 13 to 324 (312 residues), 317 bits, see alignment E=6e-99

Best Hits

Swiss-Prot: 62% identical to CBRB_DICD3: Achromobactin transport system permease protein CbrB (cbrB) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 95% identity to pwa:Pecwa_2939)

MetaCyc: 43% identical to ferric enterobactin ABC transporter membrane subunit FebD (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"ABC-type Fe3+-siderophore transport system, permease component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>HER17_RS13345 iron ABC transporter permease (Pectobacterium carotovorum WPP14)
MRQCIVTAVGVVLLLLSIVASLMLGQTTISFGAVFNALFHYDPQQIDHILVLTTRLSRTV
IAIVVGASLAVAGALMQALTRNPLASPGIFGINAGAMFTIVLLSSLFTFSSQIALAWTAY
LGAAVAGVMVYVLGTLGNARSSHLRIVLAGAAISALFISFTQALLVINQDGLDSMLFWLA
GSVSGRSLSMLLPLLPYFVIALLLALLLARHLNILVAGDEIAKGLGQRTALVRALSGLCV
IGLAGGAVAIAGNIGFVGLIVPHIVRRVLSADHRWLLPGCAIFGATLLLLADVASRLLIV
PQEVPVGAMTALLGAPFFIYLARRGMRHG