Protein Info for HER17_RS13340 in Pectobacterium carotovorum WPP14

Annotation: iron ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 160 to 195 (36 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 250 to 277 (28 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details amino acids 320 to 339 (20 residues), see Phobius details PF01032: FecCD" amino acids 31 to 340 (310 residues), 298.3 bits, see alignment E=2.9e-93

Best Hits

Swiss-Prot: 62% identical to CBRC_DICD3: Achromobactin transport system permease protein CbrC (cbrC) from Dickeya dadantii (strain 3937)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 96% identity to pwa:Pecwa_2938)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>HER17_RS13340 iron ABC transporter permease (Pectobacterium carotovorum WPP14)
MGKVYTVRVGRVSRQIDRRTSAVALPLLLVLLAVVFLSLSLGEVVLSPAQVMSGLLGKAD
RGVHFIVNDLRLPRALLALLVGGALAISGLILQSIVRNPLASPDILGITSGASAAAVFFL
SFLATAISQRWLPVAAMGGAWITAVAIYLLAWKQGASPLRLVLVGVGLSAIMGAAVTMML
VFSPIGTTLTAYVWLTGSIYGAQWQHVSALAGWLLLGAPFLVGLARHVNVHELDDALACG
VGQSVGRIRLALLTLSVALAGAAIAYAGAMAFVGLLAPHIAKKLASRSFPGLALVSALTG
GLLVMVADLIGRTAFLPLDLPAGIFISVLGTPFFIYLLLRQRY