Protein Info for HER17_RS12845 in Pectobacterium carotovorum WPP14

Annotation: YeiH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 204 to 225 (22 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 267 to 287 (21 residues), see Phobius details amino acids 302 to 322 (21 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 21 to 334 (314 residues), 350.9 bits, see alignment E=2.6e-109 TIGR00698: conserved hypothetical protein" amino acids 21 to 352 (332 residues), 366.8 bits, see alignment E=5.5e-114

Best Hits

Swiss-Prot: 60% identical to Y1307_YERPE: UPF0324 membrane protein YPO1307/y2878/YP_1285 (YPO1307) from Yersinia pestis

KEGG orthology group: None (inferred from 92% identity to pct:PC1_1656)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>HER17_RS12845 YeiH family protein (Pectobacterium carotovorum WPP14)
MALPATLPTIAPPDGAKARLPGLLLVSLITFSLLWLANIPKIAHWGPGSLTLAILIGIVL
GNSVYPRLHPLCDPGVQWAKQHLLRWGIILYGFRLSFQQVAAVGFTGVAVDLTVVTLTFL
LACWIGKRWLKLDNETVMLIGAGSSICGAAAIMATAPVVKASSNAIAVAVSTVVIFGTTA
MFLYPWLYQLNLDHHWIDITPQIVGLYFGSTIHEVAQVVAAGHAIDGATENIAVISKMLR
VMMLAPFLLILGFYLKKATQKSDAEDAIPLMFPWFALGFIAVAAFNSLQLLPTALVTQLV
QLDNVLLTMAMVALGLTTRFSAIQQAGAKPLLLALVLFLWLVVGGAGINFFFEHLFG