Protein Info for HER17_RS12475 in Pectobacterium carotovorum WPP14

Annotation: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB
  • amino acids 2 to 374 (373 residues), 666.9 bits, E=3.9e-205
• PF05958: tRNA_U5-meth_tr
  • amino acids 208 to 374 (167 residues), 55 bits, E=2.1e-18
• PF13847: Methyltransf_31
  • amino acids 236 to 307 (72 residues), 37.6 bits, E=5.8e-13
• PF05175: MTS
  • amino acids 237 to 311 (75 residues), 32.1 bits, E=2.6e-11

Best Hits

Swiss-Prot: 98% identical to RLMC_PECCP: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03212, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 97% identity to pwa:Pecwa_1963)

MetaCyc: 71% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase rumB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Protein Sequence (375 amino acids)

>HER17_RS12475 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (Pectobacterium carotovorum WPP14)
MHCARYSTGTCRSCQWLEKAYPQQLSDKQQHLEGLLPPHAVQRWLPVQPSAQSAFRNKAK
MVVSGSVERPLLGMLHRDGTAVDLCDCPLYPSSFAPVFDVLKVFIARAGLTPYNVARRRG
ELKYLLLTESTQHGTFMLRFVLRSETKLAQLRAALPWLQQQLPQLEVISANIQPVHQAIM
EGKTEIILSDAAALAEQFNQVPLYIRPQSFFQTNPQVAAALYATARDWVAELDITSMWDL
FCGVGGFGLHCASPEMRLTGIEISAEAIACARRSAEQLGLKQVEFQALDSTQFATAKAEI
PDLVLVNPPRRGIGSELCAYLSRMAPDYILYSSCNAESMAKDMTELANYRALRVQLFDMF
PHTAHYEVLTLLKRV