Protein Info for HER17_RS12335 in Pectobacterium carotovorum WPP14

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 39 to 62 (24 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 98 to 120 (23 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 202 to 225 (24 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 293 to 312 (20 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 320 (310 residues), 106.6 bits, see alignment E=2.7e-34 PF06779: MFS_4" amino acids 28 to 365 (338 residues), 26.8 bits, see alignment E=6.5e-10 PF00083: Sugar_tr" amino acids 41 to 177 (137 residues), 27.5 bits, see alignment E=3e-10 PF12832: MFS_1_like" amino acids 184 to 357 (174 residues), 26 bits, see alignment E=9.4e-10

Best Hits

Swiss-Prot: 70% identical to Y1530_YERE8: Uncharacterized MFS-type transporter YE1530 (YE1530) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K08219, MFS transporter, UMF2 family, putative MFS family transporter protein (inferred from 97% identity to pct:PC1_1723)

Predicted SEED Role

"Hypothetical MFS-type transporter protein YcaD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>HER17_RS12335 MFS transporter (Pectobacterium carotovorum WPP14)
MSAYSRPVLLLLCGLLLLTVCIAVLNTLVPLWLSYQSLPVWQVGLVGSSYFGGNLVGTLL
AGKLIKLYGFNRSYYFAALLFGIAIVGLGISGDIGSWLFWRFLAGIGCALIWVVVESALL
CSGTPTQRGQLLAAYMIAYYLGSVVGQLLLGILPSALLNVLPWMVALVILAVLPLLFTRL
PTPPEQQEKHVNMWKMLTYRSARLGVHGCIISGAILGSLYGLMPLYLSHQGMNDAQVGYW
MALLISSGIIGQWPIGRMADRYGRLLVLRVLVFVVIIGCIAMLSISHYAMAPSLFLLGCA
GFTLYPVAMSWACEKVRPDELVAMNQALLLSYTLGSLCGPSVAAVLMQSYSDRLLFVLIA
VVAMIYLMMLLRKADHHPTPLAAA