Protein Info for HER17_RS12235 in Pectobacterium carotovorum WPP14

Annotation: histidinol-phosphate transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR01141: histidinol-phosphate transaminase" amino acids 9 to 351 (343 residues), 403.3 bits, see alignment E=3.7e-125 PF00155: Aminotran_1_2" amino acids 32 to 349 (318 residues), 232.7 bits, see alignment E=3.9e-73

Best Hits

Swiss-Prot: 96% identical to HIS8_PECCP: Histidinol-phosphate aminotransferase (hisC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 96% identity to pct:PC1_1743)

MetaCyc: 74% identical to histidinol-phosphate aminotransferase (Escherichia coli K-12 substr. MG1655)
Histidinol-phosphate transaminase. [EC: 2.6.1.9]

Predicted SEED Role

"Histidinol-phosphate aminotransferase (EC 2.6.1.9)" in subsystem Histidine Biosynthesis (EC 2.6.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.9

Use Curated BLAST to search for 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>HER17_RS12235 histidinol-phosphate transaminase (Pectobacterium carotovorum WPP14)
MSSIEELARANVRALTPYQSARRLGGNGDVWLNANEYPEAPAFQLTSQTLNRYPECQPVT
VIGRYAEYAGVTPEQVLVSRGADEGIELLIRAFCEPGKDAILFCPPTYGMYAVSAETFGV
ERRTVASKSDWQLDLDAIEAQLDGTKVIYVCSPNNPTGNLIAREDLRQLLTLAQGKALVV
IDEAYIEFCPQATTSVWLDEFPHLVILRTLSKAFSLAGLRCGFTLANPEVIQLLLKVIAP
YPLSTPVADIAAQALSHEGIAKMKANVEEITSARRWLSDALKDIPCIEEIFPSESNYLLV
RFTASPSVFKTLWDQGIILRDQNKQPSLAGCLRITIGNRYECERVVAALQSLPGINA