Protein Info for HER17_RS11645 in Pectobacterium carotovorum WPP14

Annotation: two-component system sensor histidine kinase PhoQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 484 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 32 to 34 (3 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF08918: PhoQ_Sensor" amino acids 7 to 184 (178 residues), 289.9 bits, see alignment E=1.2e-90 PF14501: HATPase_c_5" amino acids 374 to 459 (86 residues), 27.2 bits, see alignment E=4.5e-10 PF02518: HATPase_c" amino acids 374 to 474 (101 residues), 57.1 bits, see alignment E=3.5e-19

Best Hits

Swiss-Prot: 62% identical to PHOQ_SHIFL: Virulence sensor protein PhoQ (phoQ) from Shigella flexneri

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 99% identity to eca:ECA2446)

MetaCyc: 62% identical to sensor histidine kinase PhoQ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (484 amino acids)

>HER17_RS11645 two-component system sensor histidine kinase PhoQ (Pectobacterium carotovorum WPP14)
MSDKKLPFSLRIRFLLATAAIVLALSLAYGVVAIIGYSVNFDKTSFRLLRGESNLYYSLA
QWRDNQLNIVTPPDVDINFPTLVLIYDENGDVLWREKHVPELEALIKPEWLNKTAYHELD
TDTDTSSAVLTGNTLLLSSLRALNGAHSNALTHSIAVNVYPKTDHLPSITIVVVDRIPQE
LQQEDVVWEWFSYVLIANLLLVLPLLWLGAHWSLRPIQHLVKQIAELEKGTRDQLDENPP
RELFSLVKNLNILLNNERQRYHKYRTTLTDLTHSLKTPLAVLQTTLRALRTGKEITIDQA
EPIMLSQISRISQQIGYYLHRASVRSEHNLLIREVHSVPALLDGLCSALNKVYQRKGVVL
TLDIPPELTFVGEKNDFMEVMGNILDNACKYCLEFVEISVQYSDHKLHLIIDDDGPGIHE
SKREMIFLRGQRADRMRPGQGIGLAVAVEIIEQYQGEILISDSALGGARVEAIFSRQNLS
QNEG