Protein Info for HER17_RS11575 in Pectobacterium carotovorum WPP14

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 transmembrane" amino acids 32 to 52 (21 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 170 to 292 (123 residues), 77.7 bits, see alignment E=8.4e-26 PF13188: PAS_8" amino acids 174 to 224 (51 residues), 29 bits, see alignment 2.2e-10 PF00989: PAS" amino acids 174 to 282 (109 residues), 47.7 bits, see alignment E=4.5e-16 PF08448: PAS_4" amino acids 180 to 287 (108 residues), 38.5 bits, see alignment E=3.7e-13 PF13426: PAS_9" amino acids 183 to 284 (102 residues), 56.1 bits, see alignment E=1.2e-18 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 295 to 451 (157 residues), 139.9 bits, see alignment E=6.4e-45 PF00990: GGDEF" amino acids 296 to 448 (153 residues), 152.6 bits, see alignment E=2.4e-48 PF00563: EAL" amino acids 471 to 704 (234 residues), 214.2 bits, see alignment E=5.7e-67

Best Hits

KEGG orthology group: None (inferred from 97% identity to pct:PC1_1877)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>HER17_RS11575 EAL domain-containing protein (Pectobacterium carotovorum WPP14)
MSRAPISKDEDKRLAALREYGIKNVLFDPGLSNLISLAANIFSVPIVLVSLVEAERQLFA
ASVGVPFCETPRDISFCAHTILKKKIMVVPDALKDARFKNNPLVVGVPYIRFYAGIPLIT
PSGHAIGTLCIIDLKPRTTFTKRDEHNLQDLASLVMDKLEMRRLELARKASQVRFENIAN
TSPDTILCVNEKGMITFWNTAAEHMLEYTDEEIIGRSINTIVPDAFVVQLNHLVTDRDSM
MKGVTLELNVQAKGGSLVPVELSVSMWEDNDNVSYGAILRDITERRRNEERLFLLAHLDP
LTGLANRTLLTSNLETALKNEPAVCIMMVDLDGFKDVNDSLGHSSGDNILVHVAKKIKAT
VRSGDVVARMGGDEFALLFPGLSDKKVAGKIAEQIIHEISQAMVIDDHQINISASIGAVL
YPEYGLTVQDLLTSADLALYQAKSEGRNCYRFFTRELLEVFQAKHAFQLEFVRAYEQHEF
EMFYQPQVKLATNEIVGAEALLRWRHPERGLLSPAAFLTALENGPWAERVGDWIVETACR
QAAEWCQASDSYFRISINLFSAQFRTGMLAQKIMDILARTGLQPSSLELEITENIILRYD
ESMLQPLNTLREAGIGIAFDDYGTGYASLSMLKNYPVTRLKIDQTFVRTMCESPPDAAIV
RAILYLGKSFGLGVIAEGVETLEQSERLRGKGCEEAQGYLFGHPMPAEEFTQLLKLNKPI
DV