Protein Info for HER17_RS11505 in Pectobacterium carotovorum WPP14

Annotation: 50S ribosomal protein L20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR01032: ribosomal protein bL20" amino acids 1 to 114 (114 residues), 176 bits, see alignment E=1.3e-56 PF00453: Ribosomal_L20" amino acids 3 to 109 (107 residues), 163.4 bits, see alignment E=8.2e-53

Best Hits

Swiss-Prot: 100% identical to RL20_PECCP: 50S ribosomal protein L20 (rplT) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K02887, large subunit ribosomal protein L20 (inferred from 97% identity to eoi:ECO111_2225)

MetaCyc: 97% identical to 50S ribosomal subunit protein L20 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L20p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>HER17_RS11505 50S ribosomal protein L20 (Pectobacterium carotovorum WPP14)
MARVKRGVVARARHKKILKQAKGYYGARSRVYRVAFQAVIKAGQYAYRDRRQRKRQFRQL
WIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKLAFSALVEKAKAALA