Protein Info for HER17_RS11320 in Pectobacterium carotovorum WPP14

Annotation: TerC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 47 to 69 (23 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 213 to 231 (19 residues), see Phobius details PF03741: TerC" amino acids 14 to 203 (190 residues), 160.9 bits, see alignment E=4.2e-51 PF00571: CBS" amino acids 368 to 417 (50 residues), 19.9 bits, see alignment 1.1e-07 PF03471: CorC_HlyC" amino acids 432 to 508 (77 residues), 47.8 bits, see alignment E=1.7e-16

Best Hits

Swiss-Prot: 72% identical to YOAE_ECOL6: UPF0053 inner membrane protein YoaE (yoaE) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 98% identity to pct:PC1_1927)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>HER17_RS11320 TerC family protein (Pectobacterium carotovorum WPP14)
MEFLLDPSIWAGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARIIGLSLALLMRLG
LLSLISWMVTLTRPLFSLGDFSFSGRDLILLFGGVFLLFKATMELHERLENKTHDGNGNR
AHASFWAVVAQIVVLDAVFSLDAVITAVGMVDHLGVMMTAVIIAMGVMLIASKPLTRFVN
EHPTVVVLCLSFLLMIGLSLMAEGLGFHIPKGYLYAAIGFSILIEMFNQIARHNFMKHQS
HRPLRERTAEAILRLMGSRKNTDDVDADEPQKKLTTEEFAEEERNMISGVLTLASRSLRS
VMTPRTEISWVDSASSVEQIRMQLLDTPHSLFPICRGSLDELIGVVRAKDLLVALETQTD
VESFAAANPPIVVPETLDVINLLPVLRRAKGSLVIIANEFGVVQGLVTPLDVLEAIAGEF
PDEDETLDIIPDGEGWLVKGGTDLHALQQVVDSSDLVDPKEEYASLAGMLLANSDEFLKV
GDTIELHRLRFHILEVSEYRIELVRVERIVDEEDAEEA