Protein Info for HER17_RS11155 in Pectobacterium carotovorum WPP14

Annotation: YeaH/YhbH family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 424 PF04285: DUF444" amino acids 4 to 420 (417 residues), 629.4 bits, see alignment E=1.6e-193

Best Hits

Swiss-Prot: 100% identical to Y1960_PECCP: UPF0229 protein PC1_1960 (PC1_1960) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K09786, hypothetical protein (inferred from 100% identity to pct:PC1_1960)

Predicted SEED Role

"UPF0229 protein YeaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (424 amino acids)

>HER17_RS11155 YeaH/YhbH family protein (Pectobacterium carotovorum WPP14)
MAYFIDRRLNGKNKSTVNRQRFLRRYKSQIKQSISEAINKRSVTDIESGESVSIPNADIN
EPMFHQGRGGRRHRVHPGNDHFVQNDKIERPQGGGGGGSGQGDASKDGEGEDEFVFQISK
DEYLDLLFEDLALPNLKKTQHRQMTEYKTHRAGYTANGVPANISVVRSLQNSLARRMAMT
AGKRRTLHELEESLEQLAHTEPAQLLEEERLRQEITELRQKIARVPFIDTFDLRYRNYER
RAEPSSQAVMFCLMDVSGSMDQATKDMAKRFYILLYLFLSRNYKNVDVVYIRHHTQAKEV
DEQEFFYSQETGGTIVSSALKLMEEVVRERYDPSQWNIYAAQASDGDNWADDSPLCHQIL
ANQLLPMVRYYSYIEITRRSHQTLWREYETLRDTFDNFAMQHIRDQDDIYPVFRELFRKQ
TVGH