Protein Info for HER17_RS10915 in Pectobacterium carotovorum WPP14

Annotation: anthranilate synthase component 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 TIGR00565: anthranilate synthase component I" amino acids 17 to 515 (499 residues), 813.9 bits, see alignment E=3e-249 PF04715: Anth_synt_I_N" amino acids 20 to 191 (172 residues), 56.5 bits, see alignment E=4.1e-19 PF00425: Chorismate_bind" amino acids 242 to 502 (261 residues), 266.7 bits, see alignment E=2.3e-83

Best Hits

Swiss-Prot: 80% identical to TRPE_SERMA: Anthranilate synthase component 1 (trpE) from Serratia marcescens

KEGG orthology group: K01657, anthranilate synthase component I [EC: 4.1.3.27] (inferred from 98% identity to eca:ECA2296)

MetaCyc: 78% identical to anthranilate synthase subunit TrpE (Escherichia coli K-12 substr. MG1655)
Anthranilate synthase. [EC: 4.1.3.27]

Predicted SEED Role

"Anthranilate synthase, aminase component (EC 4.1.3.27)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Tryptophan synthesis (EC 4.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>HER17_RS10915 anthranilate synthase component 1 (Pectobacterium carotovorum WPP14)
MQTTQPKLELLRTEAVYRNDPSAIFHQLCGARPATLLLESAEIDSKENLKSLLIVDSALR
ITALGQHVSIQALTANGASLLPLLDAALPVEITNQPRPNGRELTFPLADAMQDEDARLRS
LSVFDALRQILTLVTSPTDEREAMFLGGLFAYDLVAGFEELPALSQQQRCPDFCFYLAET
LLVLDHQKRVTALQASLFTPNQSEKQRLQQRLEQLQIQLTQPAPALPRQPIEDMTLSCNQ
SDEAFGDVVSQMQEAIRIGEIFQVVPSRRFSLPCPSPLAAYQTLKDSNPSPYMFYMQDQD
FTLFGASPESSLKYDADSRQIEIYPIAGTRPRGRRADGSLDRDLDSRIELEMRTDHKELA
EHLMLVDLARNDLARICQPGSRYVADLTKVDRYSFVMHLVSRVVGTLREDLDVLHAYRAC
MNMGTLSGAPKVRAMQLIAESEKTRRGSYGGAVGYFTAHGDLDTCIVIRSAYVEDGIATV
QAGAGVVLDSNPQAEADETRNKARAVLRAIASAHHAKEIF