Protein Info for HER17_RS10840 in Pectobacterium carotovorum WPP14

Annotation: electron transport complex subunit RsxC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 755 TIGR01945: electron transport complex, RnfABCDGE type, C subunit" amino acids 13 to 445 (433 residues), 602.1 bits, see alignment E=2.3e-185 PF13375: RnfC_N" amino acids 14 to 114 (101 residues), 107.1 bits, see alignment E=2.5e-34 PF01512: Complex1_51K" amino acids 140 to 283 (144 residues), 158.9 bits, see alignment E=5.6e-50 PF10531: SLBB" amino acids 296 to 344 (49 residues), 31.6 bits, see alignment 7.2e-11 PF13237: Fer4_10" amino acids 371 to 427 (57 residues), 37.3 bits, see alignment 1.3e-12 PF13183: Fer4_8" amino acids 375 to 430 (56 residues), 31.4 bits, see alignment 1.4e-10 PF12800: Fer4_4" amino acids 376 to 390 (15 residues), 14.3 bits, see alignment (E = 2.8e-05) amino acids 415 to 427 (13 residues), 15 bits, see alignment (E = 1.6e-05) PF13534: Fer4_17" amino acids 376 to 431 (56 residues), 27.2 bits, see alignment 2.7e-09 PF12838: Fer4_7" amino acids 377 to 430 (54 residues), 39.3 bits, see alignment 4.5e-13 PF13187: Fer4_9" amino acids 377 to 429 (53 residues), 28.8 bits, see alignment 6.1e-10

Best Hits

Swiss-Prot: 88% identical to RNFC_PECCP: Ion-translocating oxidoreductase complex subunit C (rnfC) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03615, electron transport complex protein RnfC (inferred from 88% identity to pct:PC1_2023)

Predicted SEED Role

"Electron transport complex protein RnfC" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (755 amino acids)

>HER17_RS10840 electron transport complex subunit RsxC (Pectobacterium carotovorum WPP14)
MLKLFSAFKKDRIWDFDGGIHPPEMKTQSSQTPLRQIPLPEQFIIPLKQHLGPEGEICVS
VGDKVLRGQPLTRGKGRTLPVHAPTSGTVNAIRQHTTAHPSGLSELSIIIVPDGDDRWCE
RQTFTDYRAQSTDTLLAHLHQAGIAGLGGAGFPTAAKLQGGMRGIETLIINGAECEPYIT
ADDRLMQECAEEIIQGVEILSFLLQPKRILIGIEDNKPEAISALRLALGKRSDMQLRVIP
TKYPSGGAKQLTKILTGKEVPFGKHSAAIGVLMQNVGTAFAIKRAVIDGEPLTERVVTLT
GEALRQPGNVWARLGTPVRHLLKQGGFHVNKQPMVVMGGPLMGFTLPSLDVPIVKISNCL
LAPSHTEMEPVAEEQSCIRCSKCADACPAGLLPQQLYWFSRGQEHEKARNHHLFDCIECG
ACAYVCPSNIPLVQYYRQEKAEIRAIDEEAQRAAQAKVRFDAKQARLEREKAARELRHKQ
AAAGVSTTDKDAVQAALERVRRKQTAATDVGSPIEVIPDAQPDNSAAIAARAARKALIRE
EQLREERSREKQVQQETPAVDVPSAELDDPRKAAVAAALARVKARKAAQQSEVSPESTEE
AAAPAVSNVVAEPISIVEAQEPEDPRKAAVAAAIARVKARKAAQQSTTNTEESVPASAPD
VVAEPVAVVEVQEPEDPRKAAVAAAIARVKARKAAQQSATNTEEPVPSAAPDVVAEPVAV
VEVQEPEDPRKAAVAAAIARVKARKAAQASSYQEE