Protein Info for HER17_RS10625 in Pectobacterium carotovorum WPP14

Annotation: HTH-type transcriptional regulator ArgP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00126: HTH_1" amino acids 2 to 52 (51 residues), 57.1 bits, see alignment 1.4e-19 TIGR03298: transcriptional regulator, ArgP family" amino acids 2 to 279 (278 residues), 381.8 bits, see alignment E=9.3e-119 PF03466: LysR_substrate" amino acids 80 to 276 (197 residues), 56.3 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 91% identity to eca:ECA2227)

Predicted SEED Role

"Chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (282 amino acids)

>HER17_RS10625 HTH-type transcriptional regulator ArgP (Pectobacterium carotovorum WPP14)
MEIVRSGSFEIAARKLHVTPSAISQRIKQLEDQLGQVLIVRGNPCRATPTGQALLRHAEQ
IDMLESELFSTLEMPVRPSISVAVNADSIDGWFLDAMEDACRQSNILLDILVEDQEHSAS
LLREGRVMAAVSASPEPIQGCSVEYLGTMRYRAYCSPIFHETYFAEGINVDSLQKAPLLI
FNNKDRLQSLFIESLVPTAIEPPQQFVPSTAAFVGAIFRGLGWGMIPEHMASSHTEKGEL
IPFQAGNPIDIRLYWHRWNIRSASLEALSQSVRTAAARHLFR