Protein Info for HER17_RS10360 in Pectobacterium carotovorum WPP14

Annotation: histidinol-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 TIGR02067: histidinol-phosphatase" amino acids 8 to 262 (255 residues), 286.8 bits, see alignment E=7.5e-90 PF00459: Inositol_P" amino acids 10 to 260 (251 residues), 148.5 bits, see alignment E=1.4e-47

Best Hits

KEGG orthology group: None (inferred from 92% identity to pwa:Pecwa_2480)

Predicted SEED Role

"Histidinol-phosphatase [alternative form] (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>HER17_RS10360 histidinol-phosphatase (Pectobacterium carotovorum WPP14)
MSQSLPDIAFFHELATLASQETLPRFRALTANQIETKPKEGFRFDPVTAADREAERVIRE
HITRHYPDHAIMGEEFGLSGEGPVRWVLDPVDGTRPFLCGLPVWGTLIGLMHHERAVMGM
MSQPFTGERFWADGSQAWRSDRQGEKRLSTRKGVSLEQAILHTTAPEPLAMHPAVRFEDL
AESTLMTRYGGECYAMAMLAAGQIDICVEFALQPYDIVALIPIIEQAGGIITDLNGQRAE
AGGTVVATGSPELHQQVLAILNGTPP