Protein Info for HER17_RS10255 in Pectobacterium carotovorum WPP14

Annotation: urea ABC transporter ATP-binding protein UrtD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR03411: urea ABC transporter, ATP-binding protein UrtD" amino acids 21 to 262 (242 residues), 374.5 bits, see alignment E=1.3e-116 PF00005: ABC_tran" amino acids 37 to 192 (156 residues), 99.7 bits, see alignment E=3.5e-32 PF12399: BCA_ABC_TP_C" amino acids 239 to 261 (23 residues), 32.4 bits, see alignment (E = 8.2e-12)

Best Hits

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 95% identity to pct:PC1_2158)

Predicted SEED Role

"Urea ABC transporter, ATPase protein UrtD" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>HER17_RS10255 urea ABC transporter ATP-binding protein UrtD (Pectobacterium carotovorum WPP14)
MEPKFAQPHPSDRHRHQTDPVLQLDKINVSFDGFRALTDLSLQIGVGELRCIIGPNGAGK
TTLMDVITGKTRPDNGKAFYDQYTDLTTLSPVDIARAGIGRKFQKPTVFEALTVFENLEI
ALKTDKSVWASLRARLSSEQRDRIDDTLALLRLGHERQRPAGLLSHGQKQFLEIGMLLVQ
EPHLLLLDEPAAGMTDAETAYTAELFRSLAGKHSLMVVEHDMGFVESIADRVTVLHQGQV
LAEGSLREVQANEQVIDVYLGR