Protein Info for HER17_RS09325 in Pectobacterium carotovorum WPP14

Annotation: GTP cyclohydrolase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00505: GTP cyclohydrolase II
  • amino acids 5 to 194 (190 residues), 302.4 bits, E=5.5e-95
• PF00925: GTP_cyclohydro2
  • amino acids 5 to 170 (166 residues), 223.2 bits, E=7.5e-71

Best Hits

Swiss-Prot: 99% identical to RIBA_PECAS: GTP cyclohydrolase-2 (ribA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 98% identity to pwa:Pecwa_2653)

MetaCyc: 90% identical to GTP cyclohydrolase 2 (Escherichia coli K-12 substr. MG1655)
GTP cyclohydrolase II. [EC: 3.5.4.25]

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (4/7 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.25

Protein Sequence (197 amino acids)

>HER17_RS09325 GTP cyclohydrolase II (Pectobacterium carotovorum WPP14)
MQLKRVAEAKLPTPWGDFLMVGFEEIATGHDHLALVYGDISGSVPVLARVHSECLTGDAL
FSLRCDCGFQLEAALGHIAEEGRGVLLYHRQEGRNIGLLNKIRAYALQDLGADTVEANHQ
LGFAADERDFTLCADMFKLLDVDEVRLLTNNPQKVKILNEAGINIVERVPLIVGRNPKNE
NYLATKAAKMGHLLDMK