Protein Info for HER17_RS09310 in Pectobacterium carotovorum WPP14

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 154 to 171 (18 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 340 to 347 (8 residues), see Phobius details amino acids 351 to 380 (30 residues), see Phobius details PF00375: SDF" amino acids 6 to 407 (402 residues), 367.7 bits, see alignment E=3.7e-114

Best Hits

Swiss-Prot: 38% identical to DCTA_LARHH: C4-dicarboxylate transport protein (dctA) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: None (inferred from 95% identity to pct:PC1_2374)

Predicted SEED Role

"Proton/sodium-glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>HER17_RS09310 dicarboxylate/amino acid:cation symporter (Pectobacterium carotovorum WPP14)
MKKNRLLFFIALAILLGIIVGGACHALLTAQEAKEVVSYFNLVTDVFLRLIKMIIAPLVF
ATLVSGLASMGNSSSVGRIGLKAMVWFICSSVVSLFIGMMLANIFEPGVGMNLAIPSTPI
AVETGVNTGGFTLKSFIAHIFPRSIVEAMANNEILQILVFSMFFGSALAFVKGQNKHAVT
MESMIEELAKVMFRVTDYVMRLAPLAVFSSLASSITTEGLGLLLDFGKVIGEFYLGLALL
WGLMFGAGALFLGKKATWGLIKLLREPSMLAFATASSEAAYPKTMEALSEFGVPKKITSF
VLPLGYSFNLVGSMIYQAFAILFIAQAYNIHLSLTEQTLILLTLMITSKGMAGVARAAVV
VVAATLPMFSLPEAGILLIIGIDQFLDMGRTATNVIGNGMATAVVAKLERNHDLEERDHD
HADEEAPVMVASNV