Protein Info for HER17_RS09300 in Pectobacterium carotovorum WPP14

Annotation: pyridoxal kinase PdxY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00687: pyridoxal kinase
  • amino acids 1 to 284 (284 residues), 427.7 bits, E=1.1e-132
• PF08543: Phos_pyr_kin
  • amino acids 75 to 254 (180 residues), 52.7 bits, E=4.2e-18

Best Hits

Swiss-Prot: 98% identical to PDXY_PECAS: Pyridoxal kinase PdxY (pdxY) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00868, pyridoxine kinase [EC: 2.7.1.35] (inferred from 98% identity to pct:PC1_2376)

MetaCyc: 76% identical to pyridoxal kinase 2 (Escherichia coli K-12 substr. MG1655)
Pyridoxal kinase. [EC: 2.7.1.35]

Predicted SEED Role

"Pyridoxal kinase (EC 2.7.1.35)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 2.7.1.35)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (6/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.35

Protein Sequence (286 amino acids)

>HER17_RS09300 pyridoxal kinase PdxY (Pectobacterium carotovorum WPP14)
MKNILSIQSHVVFGHAGNSAAEFPMRRMGANVWPLNTVQFSNHTQYGHWTGCVMPASHLT
DVVQGIANIDKLKTCNAVLSGYIGSAEQGEHILGIVRQVKVANPDALYFCDPVMGTPEKG
CIVAPGVSDFHCQQSLLAADIIAPNLPELELLGGRTVHNVTEAVETARALCAKGPKIVLV
KHLSRAATREDSFEMLLVTPTDAWHISRPLVEFERQPVGVGDLTSGLLLVNLLKGVALDK
ALEHTTAAVYEVMLVTKEMNEYELQLVAAQDGIANPRHHFQAIRLS