Protein Info for HER17_RS09290 in Pectobacterium carotovorum WPP14

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 16 to 227 (212 residues), 325.3 bits, E=8.5e-102
• PF01243: Putative_PNPOx
  • amino acids 48 to 131 (84 residues), 83.9 bits, E=7.4e-28
• PF10590: PNP_phzG_C
  • amino acids 187 to 227 (41 residues), 71 bits, 6.1e-24

Best Hits

Swiss-Prot: 96% identical to PDXH_PECAS: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 96% identity to eca:ECA1935)

MetaCyc: 82% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (11/12 steps found)
• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• pyridoxal 5'-phosphate salvage I (5/6 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (6/9 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (4/8 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.5

Protein Sequence (227 amino acids)

>HER17_RS09290 pyridoxamine 5'-phosphate oxidase (Pectobacterium carotovorum WPP14)
MTQERSPSDGSLLIQPADIADIRREYTRGGLRRSDLPANPLDLFERWLKQACDAKLADPT
AMSVATVDEHGQPYQRIVLLKHYDEKGMVFYTNMGSRKAHHLENNPRISLLFPWHMLERQ
VIVLGRVEKLPALEVLKYFHSRPKDSQIGAWVSKQSSRISARGVLESKFLELKQKFQNGE
VPLPSFWGGFRVVIDSVEFWQGGEHRLHDRFFYQRQDEGWQIDRLAP