Protein Info for HER17_RS09235 in Pectobacterium carotovorum WPP14

Annotation: HTH-type transcriptional repressor PurR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF00356: LacI" amino acids 3 to 48 (46 residues), 68.9 bits, see alignment 5.1e-23 PF00532: Peripla_BP_1" amino acids 59 to 322 (264 residues), 120.9 bits, see alignment E=1.5e-38 PF13407: Peripla_BP_4" amino acids 62 to 281 (220 residues), 69.9 bits, see alignment E=5.4e-23 PF13377: Peripla_BP_3" amino acids 171 to 331 (161 residues), 142.6 bits, see alignment E=2.6e-45

Best Hits

Swiss-Prot: 98% identical to PURR_PECCP: HTH-type transcriptional repressor PurR (purR) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03604, LacI family transcriptional regulator, purine nucleotide synthesis repressor (inferred from 98% identity to eca:ECA1925)

MetaCyc: 79% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Purine nucleotide synthesis repressor" in subsystem Purine nucleotide synthesis regulator

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>HER17_RS09235 HTH-type transcriptional repressor PurR (Pectobacterium carotovorum WPP14)
MATIKDVAKRAGVSTTTVSHVINKTRFVAEETKAAVRAAIKELHYSPSAVARSLKVNHTK
SIGLLATSSEAPYFAEIIEAVENSCYAKGYTLVLCNSHNDIGKQRAYLSMLAQKRVDGLL
VMCAEYPPELLSMLEDYRSIPMVVMDWGQMHSDFTDTIIDNAFEGGYMAGRYLIERGHRD
IGAIPGTQERNTGSGRYLGFLKALKEADITVRDEWVVRGDFEPESGYKAMHQILAQKQRP
TAVFCGGDIMAMGAICAADELGLRVPQDISVIGYDNVRHARFFTPALTTIHQPKERLGQS
AFSMLLDRITSKREDAHVIEVHPTLIERRSVADGPYLDYRR