Protein Info for HER17_RS08970 in Pectobacterium carotovorum WPP14

Annotation: PTS beta-glucoside transporter subunit IIABC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 109 to 136 (28 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details amino acids 287 to 311 (25 residues), see Phobius details amino acids 330 to 350 (21 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 388 to 413 (26 residues), see Phobius details amino acids 433 to 455 (23 residues), see Phobius details TIGR01995: PTS system, beta-glucoside-specific IIABC component" amino acids 3 to 631 (629 residues), 741.9 bits, see alignment E=8.7e-227 PF00367: PTS_EIIB" amino acids 9 to 41 (33 residues), 56.1 bits, see alignment (E = 2.9e-19) PF02378: PTS_EIIC" amino acids 111 to 395 (285 residues), 97.1 bits, see alignment E=1.7e-31 PF00358: PTS_EIIA_1" amino acids 486 to 611 (126 residues), 181.1 bits, see alignment E=9.7e-58 TIGR00830: PTS system, glucose subfamily, IIA component" amino acids 487 to 607 (121 residues), 160.3 bits, see alignment E=2.9e-51

Best Hits

Swiss-Prot: 70% identical to PTV3B_DICCH: PTS system beta-glucoside-specific EIIBCA component (arbF) from Dickeya chrysanthemi

KEGG orthology group: K02755, PTS system, beta-glucosides-specific IIA component [EC: 2.7.1.69] K02756, PTS system, beta-glucosides-specific IIB component [EC: 2.7.1.69] K02757, PTS system, beta-glucosides-specific IIC component (inferred from 94% identity to eca:ECA1870)

Predicted SEED Role

"PTS system, beta-glucoside-specific IIB component (EC 2.7.1.69) / PTS system, beta-glucoside-specific IIC component / PTS system, beta-glucoside-specific IIA component" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>HER17_RS08970 PTS beta-glucoside transporter subunit IIABC (Pectobacterium carotovorum WPP14)
MEYKALASEILDGVGGRGNIISVIHCATRLRFKLKDNKKADAAALKSNSGVIMVVESGGQ
FQVVVGNHVSDVYRSLLDVSGLSDQADSSSNEDGDEKKGNLLSRFIDIISGIFTPLIGVM
VASGILKGFLALSLVCGWMVETSGTYKVLFAASDALFFFFPVVLGYTAGKKFGGNPFVTM
VIGATLVHPSMIAEFGAMQNANYQQLYFLGIPVTFINYASSVIPIIFSAWLSSRLEKPLN
AILHINIRNFFTPLLCLCITVPVTFLLIGPAATWLGHMLAGGYQLIYGLNSTIAGALMGA
LWQVFVIFGLHWGLTPLMINNLSVLGHDTLLPLLTPAVLGQAGAVLGVLLRTRDMKLKGI
SGSAFSAAIFGITEPAVYGVTLPLKRPFIFGCLGGAIGAGVLGYFHTTIYSFGFPSIFTF
TQVIPPTGVDNSVWAAIIGTAIAFTFAAVATWAFGIPPQENAPAVNAPTAAPQATQNQND
ATRKQEINSPIEGTVLPLEQVGDETFASGLMGKGIAIKPQAGRVVSPVNGTVASLFKTNH
AIGLESENGAEVLIHVGIDTVKLDGQYFTAHIKTGDVVKQGDLLVEFDYQAIEKAGYDTT
TPVIITNSEDYVDVLPTAGNTVQEQGALLTLIR