Protein Info for HER17_RS08465 in Pectobacterium carotovorum WPP14

Annotation: heat shock protein HspQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02097: hemimethylated DNA binding domain
  • amino acids 5 to 96 (92 residues), 101.6 bits, E=1.3e-33
• PF08755: YccV-like
  • amino acids 5 to 94 (90 residues), 77.9 bits, E=3.2e-26

Best Hits

Swiss-Prot: 98% identical to HSPQ_PECCP: Heat shock protein HspQ (hspQ) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K11940, heat shock protein HspQ (inferred from 98% identity to pct:PC1_2540)

Predicted SEED Role

"hemimethylated DNA binding protein YccV"

Protein Sequence (102 amino acids)

>HER17_RS08465 heat shock protein HspQ (Pectobacterium carotovorum WPP14)
MIICKFGIGQQIRHRQLGFPGVVIDIDPEYSLETPTWEEISGNDTPRSEPWYHVVMEDDE
GQPIHTYLAEAQLMKEELSEHEHPSLNELAEVIQRRAPQLRH