Protein Info for HER17_RS08435 in Pectobacterium carotovorum WPP14

Annotation: YccS family putative transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 42 to 58 (17 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details amino acids 416 to 433 (18 residues), see Phobius details amino acids 440 to 460 (21 residues), see Phobius details amino acids 466 to 482 (17 residues), see Phobius details amino acids 488 to 505 (18 residues), see Phobius details amino acids 511 to 533 (23 residues), see Phobius details TIGR01667: integral membrane protein, YccS/YhfK family" amino acids 10 to 705 (696 residues), 966.8 bits, see alignment E=5.8e-295 TIGR01666: TIGR01666 family membrane protein" amino acids 10 to 706 (697 residues), 1065.4 bits, see alignment E=0 PF12805: FUSC-like" amino acids 68 to 348 (281 residues), 375.2 bits, see alignment E=1.9e-116 PF13515: FUSC_2" amino acids 407 to 527 (121 residues), 96.9 bits, see alignment E=1e-31

Best Hits

Swiss-Prot: 70% identical to YCCS_ECOLI: Inner membrane protein YccS (yccS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to pct:PC1_2546)

Predicted SEED Role

"Putative efflux (PET) family inner membrane protein YccS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (711 amino acids)

>HER17_RS08435 YccS family putative transporter (Pectobacterium carotovorum WPP14)
MLTFAPGIRRYVYNSSWLYTIRILIALSGAAAVPWWLGQPTSTIPVTLGVVAAALTDLDD
RLTGRLRNLFITLACFFVASVSIELLFPHPWLFGLGLAVSTCGFILLGALGQRYATIAFG
ALLIAIYTMLGISLYDNWYQQPIMLLIGASWYNLLTLFGHLIFPIRPLQDNLAQCYQQLA
RYLDAKANLFDPDIEEETDKPLIDVAMANSQLVATLNQTKSSLLTRLRGDRGQRGTRQTL
HYYFVAQDIHERASSSHVYYPQLREKLRYSDVLFRFQRLLSRQAKACQQLSQSILLHQKY
QHDSRIERAFVHLESAIARIAANNMADAAQIKALTYLLNNLRAIDAQLATIESEQAIEQE
NNPENTLADDKITGWSDIRLRISRHLTPQSALFRHAIRMSVLLCSGYALIQVTGLQHGYW
ILLTSLFVCQPNYNATRRRLTLRIIGTLTGILLGLPILYFVPSLEGQLTLIVISGVLFFA
FRNVQYAHATMFITLLVLLCFNLLGEGFDVAVPRIIDTLLGCAIAWAAVSFIWPDWRFRG
LPTVINKTLNANCRYLDAIMVQYYQGKDNSLPYRIARRDAHNYDAELASVVSNMSSEPHA
TRSKLDSAFRFMCLNHTLLSYISTLGAHRGKITSAETLQLLDDAVCHVDDALHCSEEESL
RINQGLKTITASLQSLSPESDSKESLIIQQIGLLIGLLPELVQLKNDMMTQ