Protein Info for HER17_RS08425 in Pectobacterium carotovorum WPP14

Annotation: cell division inhibitor SulA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 PF03846: SulA" amino acids 31 to 119 (89 residues), 163.5 bits, see alignment E=5.6e-53

Best Hits

Swiss-Prot: 96% identical to SULA_PECAS: Cell division inhibitor SulA (sulA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K13053, cell division inhibitor SulA (inferred from 94% identity to pct:PC1_2548)

Predicted SEED Role

"Cell division inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (168 amino acids)

>HER17_RS08425 cell division inhibitor SulA (Pectobacterium carotovorum WPP14)
MRTQSIRSHNIEPSSFSANQHAAEPSVATGGIISEIVYNADQPIVTHLLLPLLQQLGTQS
RWLLWLSPQQKLSRPWVQQSGLPLDKMVQLHHINPLFTVDAMERALLTGNYSAVLCWLPR
ELTEEEKVRLRHAAQAGNTYGFIMRPESAGGDAYRLFPSLKIHSTLYH