Protein Info for HER17_RS08320 in Pectobacterium carotovorum WPP14

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF01041: DegT_DnrJ_EryC1" amino acids 17 to 365 (349 residues), 342 bits, see alignment E=2.5e-106

Best Hits

Swiss-Prot: 60% identical to VIOA_SHIDY: dTDP-4-amino-4,6-dideoxy-D-glucose transaminase (vioA) from Shigella dysenteriae

KEGG orthology group: None (inferred from 98% identity to eca:ECA1733)

Predicted SEED Role

"Aminotransferase, DegT/DnrJ/EryC1/StrS family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>HER17_RS08320 DegT/DnrJ/EryC1/StrS family aminotransferase (Pectobacterium carotovorum WPP14)
MKKPVYVTSPLLPPLDEFTPYLEEIWENKWLTNNGTFHQRLEQALAEYLGVPYLSLFSNG
TLALLTALQTLRITGEVITTPYSFVATSHTLLWNGLKPVFVDIDPVTCNLDPSKLEQAIT
PATSAILPVHCYGLPADVDRIQNIADIYGLKVIYDAAHAFGVKKNDVSILNHGDLSILSF
HATKVFSTIEGGAIISQDEKTKKRIDYLKNFGFVDEVTVVAPGINAKMNEVQAAFGLLQL
KHIDSALNQRKNIYSRYCDLLKDISGIKVLSIPDDVTWNYAYFPIFFSDTFPKKRDEVYD
ILRENNIYARRYFYPLISTFPMYRGLDSAKEGGLPTASHIADNVLCLPIYPDLSDESILD
VVRCISDCVN