Protein Info for HER17_RS08115 in Pectobacterium carotovorum WPP14

Annotation: protein-glutamate O-methyltransferase CheR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF03705: CheR_N" amino acids 29 to 80 (52 residues), 67.5 bits, see alignment 1.6e-22 PF01739: CheR" amino acids 95 to 283 (189 residues), 200.4 bits, see alignment E=5.1e-63

Best Hits

Swiss-Prot: 81% identical to CHER_KLEAK: Chemotaxis protein methyltransferase (cheR) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)

KEGG orthology group: K00575, chemotaxis protein methyltransferase CheR [EC: 2.1.1.80] (inferred from 99% identity to pwa:Pecwa_1858)

MetaCyc: 74% identical to chemotaxis protein methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-glutamate O-methyltransferase. [EC: 2.1.1.80]; 2.1.1.- [EC: 2.1.1.80]

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>HER17_RS08115 protein-glutamate O-methyltransferase CheR (Pectobacterium carotovorum WPP14)
MKSTPSQNRPESASILTQMVDRLPLSDTHFRRISQLIYQRAGIVLADHKREMVYNRLVRR
LRLLGINDFGQYLALLESDPNSAEWQAFVNALTTNLTAFFREAHHFPILAEHARKRPNGY
TIWSTAASTGEEPYSLAMTLAEVLGNKASGCQVWASDIDTQVLEKATAGIYRQEELRSLS
PQQLQRFFLRGTGPHSGLVRVRPELASMVHFQQLNLLAPDWSVPAPFDAIFCRNVMIYFD
KETQERILRRFVPMLKPGGLLFAGHSENFSQISREFYLRGQTVYGLAKER