Protein Info for HER17_RS08060 in Pectobacterium carotovorum WPP14

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF11563: Protoglobin" amino acids 8 to 147 (140 residues), 56.7 bits, see alignment E=4.5e-19 PF21118: DosC_2nd" amino acids 168 to 275 (108 residues), 145.3 bits, see alignment E=1.2e-46 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 281 to 441 (161 residues), 182 bits, see alignment E=3.6e-58 PF00990: GGDEF" amino acids 284 to 438 (155 residues), 166 bits, see alignment E=9.4e-53

Best Hits

KEGG orthology group: K13069, diguanylate cyclase [EC: 2.7.7.65] (inferred from 95% identity to pct:PC1_2619)

Predicted SEED Role

"Putative Heme-regulated two-component response regulator" in subsystem Putative hemin transporter or cAMP signaling in bacteria

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>HER17_RS08060 diguanylate cyclase (Pectobacterium carotovorum WPP14)
MQLIATTSQKSFNLLRTLADQKASDFADAFYSYMLKDQEASLFLSSQQVHDRLHGSMSKW
IVDILTNTGDRLTDLINHQKKIGQIHARIGIPVDLVERGARRLKWHLYEDIAQVAEDKTL
CFDAMRFASISMDIAIEVMSKTYSQSHDLAAKNEESYRLFSILENASMERERQNASLLNW
ENAFIFSVATGTPLSSIQDLSDSEFGLWFNHKGKSSFSNIQGIRTIASIMTETDDYIRSH
STTALLTQQDYAPLLKTVRSKIYKINMLLGSLFDEVQKLESGKDTLTLLLNRRFLPTILR
HEISLAMHSNTSLSIAMIDIDHFKTVNDTYGHAAGDNILKRIAEILYESTRNSDYVFRYG
GEEFMIVLIETPKVAAHTIIERLRKKIQDHPIHLQNGESVTMTISAGIAVYSGHPDYECL
IKAADDALYQAKANGRNRIEYAPE