Protein Info for HER17_RS07690 in Pectobacterium carotovorum WPP14

Annotation: D-serine/D-alanine/glycine transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 transmembrane" amino acids 28 to 45 (18 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 104 to 126 (23 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 253 to 275 (23 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 346 to 365 (20 residues), see Phobius details amino acids 371 to 395 (25 residues), see Phobius details amino acids 415 to 435 (21 residues), see Phobius details amino acids 441 to 460 (20 residues), see Phobius details PF00324: AA_permease" amino acids 27 to 466 (440 residues), 422.5 bits, see alignment E=2.1e-130 PF13520: AA_permease_2" amino acids 31 to 451 (421 residues), 142.9 bits, see alignment E=1.4e-45

Best Hits

Swiss-Prot: 78% identical to CYCA_ECOLI: D-serine/D-alanine/glycine transporter (cycA) from Escherichia coli (strain K12)

KEGG orthology group: K11737, D-serine/D-alanine/glycine transporter (inferred from 98% identity to pwa:Pecwa_1591)

MetaCyc: 78% identical to D-serine/alanine/glycine:H+symporter (Escherichia coli K-12 substr. MG1655)
RXN0-5130; RXN0-5201; RXN0-5202; RXN0-5203; TRANS-RXN-62A; TRANS-RXN-62B

Predicted SEED Role

"D-serine/D-alanine/glycine transporter" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (470 amino acids)

>HER17_RS07690 D-serine/D-alanine/glycine transporter (Pectobacterium carotovorum WPP14)
MVEQSKEAADLTSEQGEGLQRNLTNRHIQLIAIGGAIGTGLFMGSGKTISMAGPSIIFVY
MIIGFMLFFVMRAMGELLLSNLNYKSFSDFAADLLGPWAGFFTGWTYWFCWVVTGIADVV
AISAYSQFWFPDLSQWVSSLLCVLLLLTLNLATVKLFGEMEFWFAMIKIVAIVALIVVGV
ALVMMQFSSPSGNVASFTNLWNDGGMFPKGISGFFAGFQIAVFAFVGIELVGTTAAETKN
PKVVLPRAINAIPIRIIMFYVFALIMIMSVTPWGAITADRSPFVEMFVLVGLPAAASMIN
FVVLTSAASSANSGVFSTSRMLFGLAKQGDAPKSFGVLSKRAVPSTGLMFSCICLLSGVV
LIYLIPNVMAVFTLVTTVSAILFMFIWSIILCSYLTYRKKRPQLHAESSYKMPLGIFMCW
ICLAFFAFVIVLLTLQPDTRQALIVTPLWFIVLAIAYQFIRRKKQAVDVK