Protein Info for HER17_RS07460 in Pectobacterium carotovorum WPP14

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 27 to 48 (22 residues), see Phobius details amino acids 60 to 80 (21 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 112 (99 residues), 95.7 bits, see alignment E=9.8e-32 PF00528: BPD_transp_1" amino acids 35 to 218 (184 residues), 87.2 bits, see alignment E=6.2e-29

Best Hits

Swiss-Prot: 35% identical to GLNP_RICBR: Putative glutamine transport system permease protein GlnP (glnP) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 96% identity to pct:PC1_2697)

MetaCyc: 36% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC transporter permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>HER17_RS07460 amino acid ABC transporter permease (Pectobacterium carotovorum WPP14)
MHYQWDFSLVWHNIPVLLKGLGVTLELWLLAGVLGTALGLVLGLFRVFGKRWLSLPARCF
VEIFRNTPVLIQLIWFYYAFPVLVGLQFSTFGAAALALTLYSAAYCTEIFRAGLQSIDHG
QWEGAKALGMRHSVILRRVVLPQVLRNMLPALTNRMIELAKVTSLASILAVNELMYQGRL
LSSTYYRPLEILTVVALLYFVLIWPGSYLAARLERRFRSTP