Protein Info for HER17_RS07240 in Pectobacterium carotovorum WPP14

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05368: NmrA
  • amino acids 5 to 102 (98 residues), 24.6 bits, E=3.3e-09
• PF13460: NAD_binding_10
  • amino acids 7 to 189 (183 residues), 122.2 bits, E=5e-39
• PF02254: TrkA_N
  • amino acids 9 to 72 (64 residues), 25.7 bits, E=2.5e-09

Best Hits

KEGG orthology group: None (inferred from 98% identity to eca:ECA3007)

MetaCyc: 56% identical to anaerobilin reductase monomer (Escherichia coli O157:H7)
1.3.1.M12 [EC: 1.3.1.M12]; 1.3.1.M12 [EC: 1.3.1.M12]

Predicted SEED Role

"Flavin reductase (EC 1.5.1.30)" (EC 1.5.1.30)

MetaCyc Pathways

• heme degradation V (3/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.1.M12 or 1.5.1.30

Protein Sequence (209 amino acids)

>HER17_RS07240 SDR family oxidoreductase (Pectobacterium carotovorum WPP14)
MTWLLFGAGNGVGACLLQRAIECEQAVILVLRNPEQAKHWREQGMTVVEGDACDPETVAE
ACRVAGPSAIVVSTMGGGTVNYQGHRTVIDGAEQAGIKRMLLVTSLGCGDSWPLLSPRAR
AAFGFAVREKSLAESWLQSSTLDHCIVRPGGLLDVVATHNAKLTQGAATLGLVSRWDVAL
AVDQLLQQPVFGNHIYNLIDPDLTMPAIP