Protein Info for HER17_RS07230 in Pectobacterium carotovorum WPP14

Annotation: heme anaerobic degradation radical SAM methyltransferase ChuW/HutW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 TIGR04107: putative heme utilization radical SAM enzyme HutW" amino acids 15 to 427 (413 residues), 586.6 bits, see alignment E=1.3e-180 PF04055: Radical_SAM" amino acids 58 to 226 (169 residues), 84.5 bits, see alignment E=4.8e-28

Best Hits

Swiss-Prot: 62% identical to CHUW_ECO57: Anaerobilin synthase (chuW) from Escherichia coli O157:H7

KEGG orthology group: K02495, oxygen-independent coproporphyrinogen III oxidase [EC: 1.3.99.22] (inferred from 99% identity to pct:PC1_2750)

MetaCyc: 62% identical to anaerobilin synthase (Escherichia coli O157:H7)
RXN-18337 [EC: 2.1.1.342]

Predicted SEED Role

"Radical SAM family protein HutW, similar to coproporphyrinogen III oxidase, oxygen-independent, associated with heme uptake" in subsystem Heme and Siroheme Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.22

Use Curated BLAST to search for 1.3.99.22 or 2.1.1.342

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (437 amino acids)

>HER17_RS07230 heme anaerobic degradation radical SAM methyltransferase ChuW/HutW (Pectobacterium carotovorum WPP14)
MNIDLTPYYAEPGEQPFGARRMAMPWRNHVPLSPEQIPAGWQTLKQQTVPARKRLLYLHI
PFCATHCTFCGFYQNKLRDDSTATYTRYLLQELAMEADSPLHQSAPIHAVYFGGGTPTAL
AADELSQIIRAIRTSLPLAPDCEITVEGRAMDFDDERIDACLDAGANRFSIGIQTFDTRI
RQRMARTSDKQQSIRFLERLCERDRAAVVCDLMFGLPEQTPEIWREDLAIVSDLPLDGVD
LYALNLLPTTPLAKAAENQRVALPDVVARRDFYRTGAAFLADAGWHQLSNSHWARTTRER
NLYNLLIKQGADCLAMGSGAGGNINGQAYMMERSLERYYQQIDQGQKPIMMMTPASPTGP
WQHQLQAGIEVGRIKLPQLTRHARELQPLLSQWHQAGLTCDDSTCLRLTNDGRFWANNLM
QALQQIIPQLNAEEHAH