Protein Info for HER17_RS07055 in Pectobacterium carotovorum WPP14

Annotation: dihydroneopterin triphosphate 2'-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 TIGR00526: FolB domain" amino acids 9 to 122 (114 residues), 115.7 bits, see alignment E=7.1e-38 PF02152: FolB" amino acids 10 to 118 (109 residues), 88.2 bits, see alignment E=2.8e-29

Best Hits

Swiss-Prot: 77% identical to FOLX_ECOLI: Dihydroneopterin triphosphate 2'-epimerase (folX) from Escherichia coli (strain K12)

KEGG orthology group: K07589, D-erythro-7,8-dihydroneopterin triphosphate epimerase [EC: 5.-.-.-] (inferred from 98% identity to pct:PC1_2785)

MetaCyc: 77% identical to dihydroneopterin triphosphate 2'-epimerase (Escherichia coli K-12 substr. MG1655)
H2NTPEPIM-RXN [EC: 5.1.99.7]

Predicted SEED Role

"Dihydroneopterin triphosphate epimerase" in subsystem Folate Biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.-.-.-

Use Curated BLAST to search for 5.-.-.- or 5.1.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>HER17_RS07055 dihydroneopterin triphosphate 2'-epimerase (Pectobacterium carotovorum WPP14)
MPHHYSDAIIRIKNLRLRTFIGIKDEEITNKQDVIINVVIHYPAEQARNSENIADALNYR
TITKNIIRHVEDNRFALLEKLTQDVLNIASEHEWITYAEVEVDKPFALRYADSVSMTLRY
HKA