Protein Info for HER17_RS06990 in Pectobacterium carotovorum WPP14

Annotation: tRNA pseudouridine(38-40) synthase TruA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 24 to 260 (237 residues), 252.3 bits, see alignment E=2.4e-79 PF01416: PseudoU_synth_1" amino acids 30 to 125 (96 residues), 44.8 bits, see alignment E=7.6e-16 amino acids 166 to 266 (101 residues), 105 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 96% identical to TRUA_PECAS: tRNA pseudouridine synthase A (truA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 97% identity to pct:PC1_2800)

MetaCyc: 82% identical to tRNA pseudouridine38-40 synthase (Escherichia coli K-12 substr. MG1655)
tRNA-pseudouridine synthase I. [EC: 5.4.99.12]

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>HER17_RS06990 tRNA pseudouridine(38-40) synthase TruA (Pectobacterium carotovorum WPP14)
MSETTQAEAIQADAAAENERAPLKIALGIEYDGSLYYGWQRQIDVASVQACLEKALSKVA
DEPIEVFCAGRTDAGVHGTGQVVHFTTHAIRKDAAWTMGVNANLPPDIAVRWVKTVDEDF
HARFSATARRYRYVIYNHRYRPAVLSRGMTHFYHPLDVERMERAGQCLLGENDFTSFRAV
QCQSRTPWRYVNHLKVTRHGDYIVVDIKANAFVHHMVRNIVGSLMDVGCGNRPESWIAEL
LAAKDRTLAGATARAEGLYLVAVDYPARFALPQPTMGPLFLAD