Protein Info for HER17_RS06945 in Pectobacterium carotovorum WPP14

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 12 to 40 (29 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 98 (18 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 160 to 173 (14 residues), see Phobius details amino acids 191 to 218 (28 residues), see Phobius details amino acids 233 to 251 (19 residues), see Phobius details PF01925: TauE" amino acids 14 to 249 (236 residues), 175.5 bits, see alignment E=7.6e-56

Best Hits

Swiss-Prot: 73% identical to YFCA_ECOL6: Probable membrane transporter protein YfcA (yfcA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07090, (no description) (inferred from 96% identity to pct:PC1_2809)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>HER17_RS06945 sulfite exporter TauE/SafE family protein (Pectobacterium carotovorum WPP14)
MDWLVLGPEMLAVLFFVGALAGFIDSIAGGGGLLTIPALLAAGLSPAQALATNKLQAVGG
SFSASLYFIRRRAVNLGEQKLAIALTFAGSTFGAWLIQQINADFLRQLLPLLIIGIGLYF
LLTPKIGDEDRQRRLSPLPFAIVAGSCVGFYDGFFGPGAGSFYALAFVTLYGFNLAKATA
HAKVLNFTSNFGGLLFFMLSGKVVWVVGGVMLIGQILGARLGAKMVMTKGQKLIRPMLVL
VSAVMSGKLIYDSHGHEIAVWLGQFL