Protein Info for HER17_RS06715 in Pectobacterium carotovorum WPP14

Annotation: type II secretion system minor pseudopilin GspJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 216 transmembrane" amino acids 26 to 50 (25 residues), see Phobius details PF07963: N_methyl" amino acids 22 to 46 (25 residues), 29.9 bits, see alignment (E = 3e-11) TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 23 to 45 (23 residues), 27.8 bits, see alignment (E = 1.6e-10) TIGR01711: type II secretion system protein J" amino acids 24 to 210 (187 residues), 216.3 bits, see alignment E=3.4e-68 PF11612: T2SSJ" amino acids 76 to 208 (133 residues), 143.6 bits, see alignment E=5.1e-46

Best Hits

Swiss-Prot: 100% identical to GSPJ_PECCC: Type II secretion system protein J (outJ) from Pectobacterium carotovorum subsp. carotovorum

KEGG orthology group: K02459, general secretion pathway protein J (inferred from 93% identity to eca:ECA3103)

Predicted SEED Role

"General secretion pathway protein J"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (216 amino acids)

>HER17_RS06715 type II secretion system minor pseudopilin GspJ (Pectobacterium carotovorum WPP14)
MSSKTGMCSQTRRRREPARQERQQGFTLLEMILAIAIFAALSLSAFQVLNGVMRNDEISQ
RKAERLAEIQRAFSQMDNDFSQMIARGSRGSTSMFYAGRDQLKSDDWGVSFMRNGWQNPF
GILPRSELQPVAYRLREHTLERLTHVTPDPIEGLDPGVKPLLTQVDGFRLRFFSNKTWRD
RWDNSTQLPQGIEVVLTLRDYGEMSRIFLITTGPVK