Protein Info for HER17_RS06655 in Pectobacterium carotovorum WPP14
Annotation: alanine transaminase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to ALAC_ECOLI: Glutamate-pyruvate aminotransferase AlaC (alaC) from Escherichia coli (strain K12)
KEGG orthology group: K14261, alanine-synthesizing transaminase [EC: 2.6.1.-] (inferred from 97% identity to pwa:Pecwa_1407)MetaCyc: 92% identical to glutamate--pyruvate aminotransferase AlaC (Escherichia coli K-12 substr. MG1655)
Alanine transaminase. [EC: 2.6.1.2]
Predicted SEED Role
"Uncharacterized PLP-dependent aminotransferase YfdZ"
MetaCyc Pathways
- superpathway of L-alanine biosynthesis (4/4 steps found)
- L-alanine degradation V (oxidative Stickland reaction) (2/2 steps found)
- L-alanine biosynthesis II (1/1 steps found)
- L-alanine degradation III (1/1 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
- L-alanine degradation II (to D-lactate) (2/3 steps found)
- pyruvate fermentation to acetate and alanine (2/3 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
- superpathway of L-alanine fermentation (Stickland reaction) (5/9 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
- L-alanine degradation VI (reductive Stickland reaction) (2/6 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (22/56 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Aminophosphonate metabolism
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Caprolactam degradation
- Carbon fixation in photosynthetic organisms
- Glutamate metabolism
- Lysine biosynthesis
- Lysine degradation
- Methionine metabolism
- Nucleotide sugars metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.-, 2.6.1.2
Use Curated BLAST to search for 2.6.1.- or 2.6.1.2
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (413 amino acids)
>HER17_RS06655 alanine transaminase (Pectobacterium carotovorum WPP14) MADSTSPRRFTRIDRLPPYVFNITAELKMAARRRGEDIIDFSMGNPDGPTPPHIVEKLCT VAQREDTHGYSTSRGIPRLRRAISRWYADRYEVDIDPESEAIVTIGSKEGLAHLMLATLD HGDTVLVPNPSYPIHIYGAVIAGAQVRSVPLVEGVDFFNELERAIRESIPKPKMMILGFP SNPTAQCVELDFFERVVALAKQYGVLVIHDLAYADIVYDGWKAPSIMQVPGAKDIAVEFF TLSKSYNMAGWRIGFMVGNPELVSALARIKSYHDYGTFTPLQVAAIAALEGDQQCVRDIA EQYRQRRNVLVRGLHEAGWMVDEPKASMYVWAKIPEAYAHMGSLEFAKRLLSEAKVCVSP GIGFGDYGDTHVRFALIENQDRIRQAVRGIKAMFRADGLLPTTKSLPGKGTTA