Protein Info for HER17_RS06395 in Pectobacterium carotovorum WPP14

Annotation: magnesium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 328 to 348 (21 residues), see Phobius details amino acids 354 to 373 (20 residues), see Phobius details amino acids 402 to 424 (23 residues), see Phobius details amino acids 431 to 455 (25 residues), see Phobius details amino acids 467 to 491 (25 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 64 to 490 (427 residues), 255.6 bits, see alignment E=4.3e-80 PF03448: MgtE_N" amino acids 75 to 176 (102 residues), 77.6 bits, see alignment E=1.4e-25 PF00571: CBS" amino acids 242 to 296 (55 residues), 36.1 bits, see alignment 9.9e-13 PF01769: MgtE" amino acids 362 to 485 (124 residues), 109.4 bits, see alignment E=2.2e-35

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 96% identity to pct:PC1_2951)

Predicted SEED Role

"Magnesium transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (492 amino acids)

>HER17_RS06395 magnesium transporter (Pectobacterium carotovorum WPP14)
MSSVKKLTDLRRRISLLLLENKELVEDIINRQPRVTAGDDATLGDNAALNNKIRLREKSI
LLDQTAEISELIIGLHAADLADLLESLPQDERLALWRLIPIEKRGRVLIEASDSISDDLI
GDMQDKEILRAVRILDVDEQAQLSRLVPRHLLGRILTSLEPKQRAQLRAAINYDEDCLGH
MMDFKLITVRADVTLAAVQRYLRYRQKIPNSTDKLFVTDRKNTLIGELSLASILLHSPQA
MVNDVMDDQPLRFQPEDKVEEAAGAFERYDLISSAVVDSKGKLMGRLTIEDILDVVNRES
DSNLRRSGGLTPSEDVYAPVYKSFRNRWAWLAINLCTALIASRVIGLFEHTLSHLVALAT
LMPIVAGIGGNTGNQTITMIVRALALHQLEHGKKSYLLLKELGVALVNGVIWGTIMGVVT
FLLYGNAAMGGVMMLAILLNLLLAALMGVAIPLVMMKLGRDPAIGSSVMITAITDTGGFF
IFLGLATLFLLP