Protein Info for HER17_RS06325 in Pectobacterium carotovorum WPP14

Annotation: MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 67 to 394 (328 residues), 256 bits, see alignment E=2.2e-80 PF16576: HlyD_D23" amino acids 90 to 313 (224 residues), 46.6 bits, see alignment E=3.9e-16 PF13533: Biotin_lipoyl_2" amino acids 91 to 139 (49 residues), 50 bits, see alignment 2.9e-17 PF13437: HlyD_3" amino acids 201 to 303 (103 residues), 30.2 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 95% identical to MDTA_PECCP: Multidrug resistance protein MdtA (mdtA) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 94% identity to eca:ECA3184)

MetaCyc: 66% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>HER17_RS06325 MdtA/MuxA family multidrug efflux RND transporter periplasmic adaptor subunit (Pectobacterium carotovorum WPP14)
MNAKRIRGLLVIAAVIAIAVLIWRHFTQVPPAAPGTSEQHAARTSHSGSNSNGGGRRAAM
RTLAPVQAAMTQSASVPYYLSGLGTVTAANTVTLRSRVNGQLMALHFQEGQQVKAGELLA
EIDPRPFQVELTQAQGQLAKDQASLANARQDLARYQQLVKTNLISRQELDAQTAAVRQAE
GTLKADEGAVASAQLQLDYSKITAPISGRIGLKQVDVGNYITSGDTNGIVVITQTYPIDV
VFTVPEAEISTILSAQKSGQPPVVEAWDRANQKKLSQGILLSMDNQIDATTGTIKLKARF
DNLDDALFPNQFVNIRMKVDTLKNAVVAPSAAVQMGNEGRFVWILNDKNEVSKRQVTTSI
QYGQLVVVTAGLDANVQVVTDGIDRLTEGAKVEVIPSALTEKTPAIAGEKS