Protein Info for HER17_RS06290 in Pectobacterium carotovorum WPP14

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 PF13302: Acetyltransf_3" amino acids 15 to 155 (141 residues), 127.8 bits, see alignment E=1e-40 PF13420: Acetyltransf_4" amino acids 21 to 173 (153 residues), 37.3 bits, see alignment E=5.7e-13 PF00583: Acetyltransf_1" amino acids 43 to 154 (112 residues), 46.9 bits, see alignment E=6.4e-16

Best Hits

Swiss-Prot: 37% identical to YP20_BACLI: Uncharacterized N-acetyltransferase p20 (p20) from Bacillus licheniformis

KEGG orthology group: None (inferred from 94% identity to pct:PC1_2974)

Predicted SEED Role

"FIG00904746: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>HER17_RS06290 GNAT family N-acetyltransferase (Pectobacterium carotovorum WPP14)
MTALFSETTRIETPRLLLRPLYRDDAPALFAFMSDPVVMRFWNHPPWQHIEQAHDAIDEH
WSALCAGQHMKLGLEVKESGELIGTCVLFNLEIESKRAEIGYCLAASAQGKGYMAEALSA
LRDFAFETAGLSRLEAEIDPRNVASARSLERLGFTQEGLLKQRWIVDGEVSDSALYGLLA
AKR