Protein Info for HER17_RS06160 in Pectobacterium carotovorum WPP14

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 10 to 205 (196 residues), 276 bits, E=1.2e-86
• PF00117: GATase
  • amino acids 11 to 200 (190 residues), 155.3 bits, E=3.9e-49
• PF07722: Peptidase_C26
  • amino acids 76 to 183 (108 residues), 35.5 bits, E=2.3e-12
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 212 to 525 (314 residues), 512.8 bits, E=3.3e-158
• PF02540: NAD_synthase
  • amino acids 220 to 257 (38 residues), 26.6 bits, 8.1e-10
• PF00958: GMP_synt_C
  • amino acids 433 to 524 (92 residues), 147.7 bits, E=2.1e-47

Best Hits

Swiss-Prot: 98% identical to GUAA_PECAS: GMP synthase [glutamine-hydrolyzing] (guaA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to pct:PC1_3003)

MetaCyc: 91% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (525 amino acids)

>HER17_RS06160 glutamine-hydrolyzing GMP synthase (Pectobacterium carotovorum WPP14)
MTQNIHQHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIRGFNPNGIILSGGP
ESTTEFGSPRAPEYVFNAGVPVLGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVKTDSA
LVRDIQDALSATGAPLLDVWMSHGDKVTAIPEGFETVASTDTCPFAIMANEEKRFYGVQF
HPEVTHTRQGQRMLERFVLDICQCEALWTPAKIIDDAVNRIREQVGNDHVILGLSGGVDS
SVTAMLLHRAIGDRLTCVFVDNGLLRLNEADQVLEMFGDQFGLNIVHVAAEDRFLSELAG
EDEPEAKRKIIGRVFVGVFDEEASKQEQVKWLAQGTIYPDVIESAASATGKAHVIKSHHN
VGGLPKEMKLGLVEPLKELFKDEVRKIGLELGLPYNMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVALRAVETIDF
MTAHWAHLPYDFLGRVSNRIINEVDGISRVVYDVSGKPPATIEWE