Protein Info for HER17_RS06095 in Pectobacterium carotovorum WPP14

Annotation: cytoskeleton protein RodZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 transmembrane" amino acids 112 to 133 (22 residues), see Phobius details PF12844: HTH_19" amino acids 16 to 84 (69 residues), 31.7 bits, see alignment E=3.3e-11 PF13560: HTH_31" amino acids 16 to 56 (41 residues), 33.4 bits, see alignment 1.1e-11 PF13413: HTH_25" amino acids 18 to 79 (62 residues), 48.8 bits, see alignment E=1.2e-16 PF01381: HTH_3" amino acids 19 to 53 (35 residues), 26.4 bits, see alignment 1.5e-09 PF13464: RodZ_C" amino acids 256 to 328 (73 residues), 86.9 bits, see alignment E=1.8e-28

Best Hits

Swiss-Prot: 88% identical to RODZ_PECAS: Cytoskeleton protein RodZ (rodZ) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 88% identity to eca:ECA3221)

Predicted SEED Role

"FIG021952: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (332 amino acids)

>HER17_RS06095 cytoskeleton protein RodZ (Pectobacterium carotovorum WPP14)
MNTEATQDTTEAKLPGERLREARERLGLTQQTIAERLCLKITTVRDIEDGTTPADLAPTF
LRGYIRSYAKLVHLPEDELLPSVDKQAIPKTISVSPMQSFSLKKSRKKRDGWLMTITWLV
VLVVLGLTGAWWWQNHQAQQAEINSMVDHASSIQAQTEGQSVPLMDNGTAQEMATPGSAP
SPASTPVDLSATGTETPSTPSSVSTPSAAPSSQSPLHANAAQPQTAGNVLLGAGAVAPAA
GTVAEANPVSAAHALVMTFTADCWLEVTDASGKKLFSGMQRNGGTLNLDGQSPYKLKIGA
PAAVQIQFQGKPVDLSRFVRSSQVARLTLTAE