Protein Info for HER17_RS05955 in Pectobacterium carotovorum WPP14

Annotation: 3-phenylpropionate MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 8 to 28 (21 residues), see Phobius details amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 206 to 229 (24 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 330 to 352 (23 residues), see Phobius details amino acids 358 to 377 (20 residues), see Phobius details PF12832: MFS_1_like" amino acids 8 to 361 (354 residues), 196.6 bits, see alignment E=1.4e-61 PF07690: MFS_1" amino acids 9 to 315 (307 residues), 51.2 bits, see alignment E=1.9e-17 PF01306: LacY_symp" amino acids 9 to 368 (360 residues), 38.7 bits, see alignment E=1.1e-13 PF03825: Nuc_H_symport" amino acids 10 to 351 (342 residues), 37 bits, see alignment E=4.2e-13

Best Hits

Swiss-Prot: 68% identical to HCAT_ECOLI: Probable 3-phenylpropionic acid transporter (hcaT) from Escherichia coli (strain K12)

KEGG orthology group: K05820, MFS transporter, PPP family, 3-phenylpropionic acid transporter (inferred from 97% identity to eca:ECA3249)

Predicted SEED Role

"Probable 3-phenylpropionic acid transporter" in subsystem Cinnamic Acid Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>HER17_RS05955 3-phenylpropionate MFS transporter (Pectobacterium carotovorum WPP14)
MVLQSTRWLALSYFTYFFCYGVFLPFWGGWLKGEGLSAESIGMLLGAGLVARFVGSLVIT
PSVKDPSKLITVLRGLALLSLALAIGFWLGNAWLWLMIVMIGFNLFFAPLVPLTDALAAT
WQRQVVMDYGKVRVWGSIAFVIASAATGELVAIWGHPAILAILSAGLVVMLLGMLLRPSV
MPQAAASTAQSVNVTPWKTLLTEPAVWRFLLCVSLLQGAHAAYYGFSVIYWQDSGYSASI
IGYLWSLGVVAEIVIFTFSQRLFRRWSARQLLLLSAVCGVVRWGLMGVTVALPWLIVIQI
LHCGTFTVCHLAAMRFIAARTGGDILRLQAVYSALAMGGSIAVMTMVSGFLFEHLQGGTF
WVMALLAVPALFIRPSVSHHTAVEKA